OBP2A Recombinant Protein (OPCA03369)

Name OBP2A Recombinant Protein (OPCA03369)
Supplier Aviva Systems Biology
Catalog OPCA03369
Category Protein
Prices $250.00
Sizes 50 µg
Nature Recombinant
Source Human
Tag/Conjugation His-SUMO-tag
Purity Greater than 90% as determined by SDS-PAGE.
SwissProt/Accession Q9NY56
Gene OBP2A
Sequence LSFTLEEEDITGTWYVKAMVVDKDFPEDRRPRKVSPVKVTALGGGNLEATFTFMREDRCIQKKILMRKTEEPGKFSAYGGRKLIYLQELPGTDDYVFYCKDQRRGGLRYMGKLVGRNPNTNLEALEEFKKLVQHKGLSEEDIFMPLQTGSCVLEH
Description This gene encodes a small extracellular protein belonging to the lipocalin superfamily
Supplier Page Shop