| Name | SLURP1 Recombinant Protein (OPCA03412) |
|---|---|
| Supplier | Aviva Systems Biology |
| Catalog | OPCA03412 |
| Category | Protein |
| Prices | $365.00 |
| Sizes | 50 µg |
| Nature | Recombinant |
| Source | Human |
| Tag/Conjugation | His-tag |
| Purity | Greater than 90% as determined by SDS-PAGE. |
| SwissProt/Accession | P55000 |
| Gene | SLURP1 |
| Sequence | LKCYTCKEPMTSASCRTITRCKPEDTACMTTLVTVEAEYPFNQSPVVTRSCSSSCVATDPDSIGAAHLIFCCFRDLCNSEL |
| Description | The protein encoded by this gene is a member of the Ly6/uPAR family but lacks a GPI-anchoring signal sequence |
| Supplier Page | Shop |