| Name | HCRTR2 Recombinant Protein (OPCA03493) |
|---|---|
| Supplier | Aviva Systems Biology |
| Catalog | OPCA03493 |
| Category | Protein |
| Prices | $365.00 |
| Sizes | 50 µg |
| Nature | Recombinant |
| Source | Human |
| Tag/Conjugation | His-tag |
| Purity | Greater than 90% as determined by SDS-PAGE. |
| SwissProt/Accession | O43614 |
| Gene | HCRTR2 |
| Sequence | MSGTKLEDSPPCRNWSSASELNETQEPFLNPTDYDDEEFLRYLWREYLHPKEYEWVLIAGYIIVFVVALIGNVLV |
| Description | The protein encoded by this gene is a G-protein coupled receptor involved in the regulation of feeding behavior |
| Supplier Page | Shop |