Human Fragilis full length protein
| Name | Human Fragilis full length protein |
|---|---|
| Supplier | Abcam |
| Catalog | ab92921 |
| Category | Protein |
| Applications | WB ELISA SDS-PAGE MS |
| Species Reactivities | Human |
| Nature | Recombinant |
| Source | E. coli |
| SwissProt/Accession | Q01628 |
| Gene | IFITM3 |
| Residue | 1 to 133 |
| Sequence | MNHTVQTFFSPVNSGQPPNYEMLKEEHEVAVLGAPHNPAPPTSTVIHIRS ETSVPDHVVWSLFNTLFMNPCCLGFIAFAYSVKSRDRKMVGDVTGAQAYA STAKCLNIWALILGILMTILLIVIPVLIFQAYG |
| Supplier Page | Shop |
Product images
ab92921 on 10% SDS-PAGE stained with Coomassie Blue. Predicted band size is 43 kDa.
![Anti-Fragilis antibody [EPR5242] ( ab109429 ) at 1/1000 dilution + Human Fragilis full length protein (ab92921) at 0.01 µg Secondary Goat Anti-Rabbit IgG H&L (HRP) preadsorbed ( ab97080 ) at 1/5000 dilution developed using the ECL technique Performed under reducing conditions. Exposure time : 10 seconds](http://www.bioprodhub.com/system/product_images/pp_products/2/sub_1/8447_Fragilis-Primary-antibodies-ab109429-5.jpg)
Anti-Fragilis antibody [EPR5242] ( ab109429 ) at 1/1000 dilution + Human Fragilis full length protein (ab92921) at 0.01 µg Secondary Goat Anti-Rabbit IgG H&L (HRP) preadsorbed ( ab97080 ) at 1/5000 dilution developed using the ECL technique Performed under reducing conditions. Exposure time : 10 seconds