Active human IL13 full length protein

Name Active human IL13 full length protein
Supplier Abcam
Catalog ab191668
Category Protein
Prices $192.00
Sizes 10 µg
Applications FA SDS-PAGE
Species Reactivities Human
Nature Recombinant
Source E. coli
Purity >95% by SDS-PAGE .
Bioactivity The ED 50 determined by the dose-dependent proliferation of TF-1 cells was ≤ 2.0 ng/ml, corresponding to a specific activity of ≥ 1.0 x 10 6 units/mg.
Endotoxin < 1.000 Eu/µg
SwissProt/Accession P35225
Gene IL13
Residue 25 to 146
Sequence LTCLGGFASPGPVPPSTALRELIEELVNITQNQKAPLCNGSMVWSINLTA GMYCAALESLINVSGCSAIEKTQRMLSGFCPHKVSAGQFSSLHVRDTKIE VAQFVKDLLLHLKKLFREGRFN
Supplier Page Shop