Active human IL15 full length protein
| Name | Active human IL15 full length protein |
|---|---|
| Supplier | Abcam |
| Catalog | ab174074 |
| Category | Protein |
| Prices | $257.00 |
| Sizes | 10 µg |
| Applications | FA SDS-PAGE |
| Species Reactivities | Human |
| Nature | Recombinant |
| Source | HEK 293 cells |
| Purity | >95% by SDS-PAGE . |
| Bioactivity | The bio-activity was determined by dose-dependent stimulation of the proliferation of mouse CTLL-2 cells. The ED 50 <0.5ng/ml, corresponding to a specific activity of >2X10 6 Unit/mg. |
| Endotoxin | < 1.000 Eu/µg |
| SwissProt/Accession | P40933 |
| Gene | IL15 |
| Residue | 49 to 162 |
| Sequence | NWVNVISDLKKIEDLIQSMHIDATLYTESDVHPSCKVTAMKCFLLELQVI SLESGDASIHDTVENLIILANNSLSSNGNVTESGCKECEELEEKNIKEFL QSFVHIVQMFINTS |
| Supplier Page | Shop |
Product images
The purity of ab174074 (predicted MW of 13kDa) was determined by SDS-PAGE and staining overnight with Coomassie Blue. DTT reduced ab174074 migrates as 16 kDa protein due to glycosylation.