Human G gamma4 full length protein
| Name | Human G gamma4 full length protein |
|---|---|
| Supplier | Abcam |
| Catalog | ab177602 |
| Category | Protein |
| Applications | SDS-PAGE |
| Species Reactivities | Human |
| Nature | Recombinant |
| Source | E. coli |
| Tag/Conjugation | His tag N-Terminus |
| Purity | > 85 % by SDS-PAGE. ab177602 was purified by using anion-exchange chromatography (DEAE sepharose resin) and gel-filtration chromatography. |
| SwissProt/Accession | NP_001092192 |
| Gene | GNG4 |
| Residue | 1 to 72 |
| Sequence | MGSSHHHHHHSSGLVPRGSHMGSMKEGMSNNSTTSISQARKAVEQLKMEA CMDRVKVSQAAADLLAYCEAHVREDPLIIPVPASENPFREKKFFC |
| Supplier Page | Shop |
Product images
15% SDS-PAGE analysis of ab177602 (3µg).