Active human IL17E full length protein
| Name | Active human IL17E full length protein |
|---|---|
| Supplier | Abcam |
| Catalog | ab174086 |
| Category | Protein |
| Prices | $186.00 |
| Sizes | 10 µg |
| Applications | FA SDS-PAGE |
| Species Reactivities | Human |
| Nature | Recombinant |
| Source | HEK 293 cells |
| Tag/Conjugation | His tag C-Terminus |
| Purity | >95% by SDS-PAGE . |
| Bioactivity | The activity is determined by the dose-dependant production of IL-8 by Human PBMCs. The expected ED 50 for this effect is 12-25 ng/ml. |
| Endotoxin | < 1.000 Eu/µg |
| SwissProt/Accession | Q9H293 |
| Gene | IL25 |
| Residue | 33 to 177 |
| Sequence | YSHWPSCCPSKGQDTSEELLRWSTPVPPLEPARPNRHPESCRASEDGPLS RAISPWRYELDRDLNRLPQDLYHARCLCPHCVSQTGSHMDPRGNSELLYH NQTVFYRPCHGEKGTHKGYCLERRLYRVSLACVCVRPRVMG |
| Supplier Page | Shop |
Product images
Reduced SDS-PAGE analysis of ab174086. Staining overnight with Coomassie Blue. Calculated MW of 16.7 kDa. DTT-reduced protein migrates as 24 kDa, 27 kDa and 31 kDa due to different glycosylation.