Active human IL17F full length protein
| Name | Active human IL17F full length protein |
|---|---|
| Supplier | Abcam |
| Catalog | ab174087 |
| Category | Protein |
| Prices | $200.00 |
| Sizes | 10 µg |
| Applications | FA SDS-PAGE |
| Species Reactivities | Human |
| Nature | Recombinant |
| Source | HEK 293 cells |
| Purity | >95% by SDS-PAGE . |
| Bioactivity | The specific activity was determined by the dosedependent induction of IL-6 secretion from NDHF adult fibroblasts. The ED 50 for this effect is typically 100 to 500 ng/ml. |
| Endotoxin | < 1.000 Eu/µg |
| SwissProt/Accession | Q96PD4 |
| Gene | IL17F |
| Residue | 31 to 163 |
| Sequence | RKIPKVGHTFFQKPESCPPVPGGSMLDIGIINENQRVSMSRNIESRSTSP WYTVTWDPNRYPSEVVQAQCRNLGCINAQGKEDSMNSVPIQQETLVVRRK HQGCSVSFLEKVLVTVGCTCVTPVIHHVQ |
| Supplier Page | Shop |
Product images
Reduced SDS-PAGE using ab174087. Staining overnight with Coomassie Blue. Calculated MW of 15.5 kDa. DTT-reduced protein migrates as 21 kDa due to glycosylation.