Active human IL17F full length protein
| Name | Active human IL17F full length protein |
|---|---|
| Supplier | Abcam |
| Catalog | ab85600 |
| Category | Protein |
| Prices | $340.00 |
| Sizes | 5 µg |
| Applications | SDS-PAGE |
| Species Reactivities | Human |
| Nature | Recombinant |
| Source | HEK 293 cells |
| Purity | > 95 % by SDS-PAGE. |
| Bioactivity | Activity : The activity of IL17F is measured by its ability to induce IL6 production in NHDF cells. The ED 50 is typically between 0.04 and 0.1 ng/ml. |
| SwissProt/Accession | Q96PD4 |
| Gene | IL17F |
| Sequence | RKIPKVGHTFFQKPESCPPVPGGSMKLDIGIINENQRVSMSRNIESRSTS PWNYT VTWDPNRYPSEVVQAQCRNLGCINAQGKEDISMNSVPIQQETL VVRRKHQGCSVS FQLEKVLVTVGCTCVTPVIHHVQ |
| Supplier Page | Shop |
Product images
1D SDS-PAGE of ab85600 before and after treatment with glycosidases to remove oligosaccharides. Lane 1: ab85600 Lane 2: ab85600 treated with PNGase F to remove potential N-linked glycans Lane 3: ab85600 treated with a glycosidase cocktail to remove potential N- and O-linked glycans. Approximately 5 µg of protein was loaded per lane; Gel was stained using Coomassie. Drop in MW after treatment with PNGase F indicates presence of N-linked glycans. Additional bands in lane 2 and lane 3 are glycosidase enzymes.