Active human IL2 Receptor beta protein fragment
| Name | Active human IL2 Receptor beta protein fragment |
|---|---|
| Supplier | Abcam |
| Catalog | ab174003 |
| Category | Protein |
| Prices | $414.00 |
| Sizes | 20 µg |
| Applications | SDS-PAGE FA |
| Species Reactivities | Human |
| Nature | Recombinant |
| Source | HEK 293 cells |
| Tag/Conjugation | His tag C-Terminus |
| Purity | >90% by SDS-PAGE. |
| Bioactivity | Measured by its ability to inhibit the IL-15-dependent proliferation of MO7e Human megakaryocytic leukemic cells. The ED 50 for this effect is typically 0.5 - 2.5 µg/mL in the presence of 4.0 ng/mL of recombinant Human IL-15. |
| Endotoxin | < 1.000 Eu/µg |
| SwissProt/Accession | P14784 |
| Gene | IL2RB |
| Residue | 27 to 239 |
| Sequence | AVNGTSQFTCFYNSRANISCVWSQDGALQDTSCQVHAWPDRRRWNQTCEL LPVSQASWACNLILGAPDSQKLTTVDIVTLRVLCREGVRWRVMAIQDFKP FENLRLMAPISLQVVHVETHRCNISWEISQASHYFERHLEFEARTLSPGH TWEEAPLLTLKQKQEWICLETLTPDTQYEFQVRVKPLQGEFTTWSPWSQP LAFRTKPAALGKD |
| Supplier Page | Shop |
Product images
SDS-PAGE analysis of reduced ab174003 stained overnight with Coomassie Blue. DTT-reduced Protein migrates as 40 kDa due to glycosylation.