Active human IL20RB protein fragment
| Name | Active human IL20RB protein fragment |
|---|---|
| Supplier | Abcam |
| Catalog | ab179978 |
| Category | Protein |
| Prices | $400.00 |
| Sizes | 100 µg |
| Applications | SDS-PAGE FA |
| Species Reactivities | Human |
| Nature | Recombinant |
| Source | HEK 293 cells |
| Purity | >90% by SDS-PAGE. |
| Bioactivity | Measured by its binding ability in a functional ELISA. When Recombinant Human IL19 protein is present at 0.2 µg/mL, the concentration of ab179978 that produces 50% of the optimal binding response is approximately 5-50 ng/ml. |
| Endotoxin | < 1.000 Eu/µg |
| SwissProt/Accession | Q6UXL0 |
| Gene | IL20RB |
| Residue | 30 to 230 |
| Sequence | DEVAILPAPQNLSVLSTNMKHLLMWSPVIAPGETVYYSVEYQGEYESLYT SHIWIPSSWCSLTEGPECDVTDDITATVPYNLRVRATLGSQTSAWSILKH PFNRNSTILTRPGMEITKDGFHLVIELEDLGPQFEFLVAYWRREPGAEEH VKMVRSGGIPVHLETMEPGAAYCVKAQTFVKAIGRYSAFSQTECVEVQGE A |
| Supplier Page | Shop |
Product images
SDS-PAGE analysis of reduced ab179978 stained overnight with Coomassie Blue. Lane 1: DTT-reduced protein. Lane 2: Non-reduced protein. As a result of glycosylation, DTT-reduced Protein migrates as 50 kDa and non-reduced protein migrates as 100 kDa.