| Name | Human IL1F2 protein |
|---|---|
| Supplier | Biorbyt |
| Catalog | orb49779 |
| Category | Protein |
| Prices | $408.00, $595.00, $1,301.00, $1,828.00 |
| Sizes | 10 μg, 50 μg, 500 μg, 1 mg |
| Applications | SDS-PAGE |
| Species Reactivities | Mouse |
| Purity | >95% as determined by reducing SDS-PAGE. |
| Bioactivity | ED50 is less than 0.01 ng/ml as determined by the dosedependent stimulation of mouse D10S cells. Specific Activity of 1.0 x 108 IU/mg. |
| Endotoxin | Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test. |
| Gene | Il1b |
| Sequence | VPIRQLHYRLRDEQQKSLVLSDPYELKALHLNGQNINQQVIFSMSFVQGEPSNDKIPVALGLKGKNLYLSCVMKDGTPTLQLESVDPKQYPKKKMEKRFVFNKIEVKSKVEFESAEFPNWYISTSQAEHKPVFLGNNSGQDIIDFTMESVSS |
| Description | Recombinant human IL1F2 protein |
| Supplier Page | Shop |