Human GDNF Receptor alpha 1 protein fragment
| Name | Human GDNF Receptor alpha 1 protein fragment |
|---|---|
| Supplier | Abcam |
| Catalog | ab158513 |
| Category | Protein |
| Applications | WB ELISA |
| Species Reactivities | Human |
| Nature | Recombinant |
| Source | Wheat germ |
| Tag/Conjugation | proprietary tag N-Terminus |
| SwissProt/Accession | P56159 |
| Gene | GFRA1 |
| Residue | 267 to 360 |
| Sequence | CQPESRSVSSCLKENYADCLLAYSGLIGTVMTPNYIDSSSLSVAPWCDCS NSGNDLEECLKFLNFFKDNTCLKNAIQAFGNGSDVTVWQPAFPV |
| Supplier Page | Shop |
Product images
ab158513 on a 12.5% SDS-PAGE stained with Coomassie Blue.