Name | Human PF 4 protein |
---|---|
Supplier | Biorbyt |
Catalog | orb80689 |
Category | Protein |
Prices | $187.00, $323.00, $3,128.00 |
Sizes | 5 μg, 20 μg, 1 mg |
Applications | SDS-PAGE |
Species Reactivities | Human |
Purity | >98% |
Bioactivity | Determined by its ability to chemoattract human neutrophils using a concentration range of 10.0-100.0 ng/ml. |
Gene | PF4 |
Sequence | VTSAGPEESDGDLSCVCVKTISSGIHLKHITSLEVIKAGRHCAVPQLIATLKNGRKICLDRQAPLYKKVIKKILES |
Description | Recombinant Human PF 4 protein |
Supplier Page | Shop |