Active human IL3 full length protein
| Name | Active human IL3 full length protein |
|---|---|
| Supplier | Abcam |
| Catalog | ab167719 |
| Category | Protein |
| Prices | $239.00 |
| Sizes | 10 µg |
| Applications | FA SDS-PAGE |
| Species Reactivities | Human |
| Nature | Recombinant |
| Source | HEK 293 cells |
| Tag/Conjugation | His tag C-Terminus |
| Purity | >90% by SDS-PAGE. |
| Bioactivity | The bio-activity was determined by its ability to induce IFN-gamma production by NK-92 cells. The ED 50 <0.1 ng/ml, corresponding to a specific activity of >1X10 7 Unit/mg |
| Endotoxin | < 1.000 Eu/µg |
| SwissProt/Accession | P08700 |
| Gene | IL3 |
| Residue | 20 to 152 |
| Sequence | APMTQTTPLKTSWVNCSNMIDEIITHLKQPPLPLLDFNNLNGEDQDILME NNLRRPNLEAFNRAVKSLQNASAIESILKNLLPCLPLATAAPTRHPIHIK DGDWNEFRRKLTFYLKTLENAQAQQTTLSLAIF |
| Supplier Page | Shop |
Product images
SDS-PAGE of reduced ab167719 stained overnight with Coomassie Blue. DTT-reduced protein migrates as 30 and 38 kDa monomers due to glycosylation.