Active human IL3 full length protein
| Name | Active human IL3 full length protein |
|---|---|
| Supplier | Abcam |
| Catalog | ab195084 |
| Category | Protein |
| Applications | SDS-PAGE FA |
| Species Reactivities | Human |
| Nature | Recombinant |
| Source | HEK 293 cells |
| Tag/Conjugation | His tag C-Terminus , StrepII tag N-Terminus |
| Purity | > 80 % by SDS-PAGE. |
| Bioactivity | Biologial Activity: ED 50 is 0.005-0.5 ng/ml as determined by a TF-1 cell proliferation assay. |
| Endotoxin | < 0.100 Eu/µg |
| SwissProt/Accession | P08700 |
| Gene | IL3 |
| Residue | 20 to 152 |
| Sequence | APMTQTTPLKTSWVNCSNMIDEIITHLKQPPLPLLDFNNLNGEDQDILME NNLRRPNLEAFNRAVKSLQNASAIESILKNLLPCLPLATAAPTRHPIHIK DGDWNEFRRKLTFYLKTLENAQAQQTTLSLAIF |
| Supplier Page | Shop |
Product images
The bioactivity of purified recombinant ab195084 was determined by a TF-1 cell proliferation assay.