Human MHC class chain-related gene A protein

• Supplier: Biorbyt
• Catalog: orb80176
• Category: Protein
• Prices: $221.00, $357.00, $425.00, $629.00
• Sizes: 10 μg, 50 μg, 100 μg, 250 μg
• Applications: SDS-PAGE HPLC FA
• Species Reactivities: Human
• Nature: Recombinant
• Source: E.coli
• Purity: > 95.0% as determined by RP-HPLC and analysis by SDS-PAGE
• Bioactivity: Measured by its ability to bind MICA antibody in ELISA.
• Gene: MICA
• Sequence: EPHSLRYNLTVLSWDGSVQSGFLAEVHLDGQPFLRYDRQKCRAKPQGQWAEDVLGNKTWDRETRDLTGNGKDLRMTLAHIKDQKEGLHSLQEIRVCEIHEDNSTRSSQHFYYDGELFLSQNLETEEWTVPQSSRAQTLAMNVRNFLKEDAMKTKTHYHAMHADCLQELRRYLESGVVLRRTVPPMVNVTRSEASEGNITVTCRASSFYPRNIILTWRQDGVSLSHDTQQWGDVLPDGNGTYQTWVATRICRGEEQRFTCYMEHSGNHSTHPVPSGKVLVLQSH.
• Description: MICA Human Recombinant produced in E.coli is a single, non-glycosylated polypeptide chain containing 320 amino acids and having a molecular mass of 36kDa. The sequence contains the full length extracellular domain of the mature human MICA (amino acid residues Ala23 Gln308) The MICA is purified by proprietary chromatographic techniques.