| Name | Active human IL3 full length protein |
|---|---|
| Supplier | Abcam |
| Catalog | ab200297 |
| Category | Protein |
| Prices | $101.00 |
| Sizes | 2 µg |
| Applications | FA HPLC SDS-PAGE |
| Species Reactivities | Human |
| Nature | Recombinant |
| Source | E. coli |
| Purity | > 97 % by SDS-PAGE. > 97 % by HPLC analysis. |
| Bioactivity | Fully biologically active when compared to standard. The ED 50 as determined by the dose-dependant stimulation of the proliferation of Human TF-1 cells is less than 0.1 ng/mL, corresponding to a Specific Activity of 1.0 x 10 7 IU/mg. |
| Endotoxin | < 1.000 Eu/µg |
| SwissProt/Accession | P08700 |
| Gene | IL3 |
| Residue | 20 to 152 |
| Sequence | APMTQTTSLKTSWVNCSNMIDEIITHLKQPPLPLLDFNNLNGEDQDILME NNLRRPNLEAFNRAVKSLQNASAIESILKNLLPCLPLATAAPTRHPIHIK DGDWNEFRRKLTFYLKTLENAQAQQTTLSLAIF |
| Supplier Page | Shop |