Human Glutathione S Transferase mu protein fragment
| Name | Human Glutathione S Transferase mu protein fragment |
|---|---|
| Supplier | Abcam |
| Catalog | ab158600 |
| Category | Protein |
| Applications | ELISA WB |
| Species Reactivities | Human |
| Nature | Recombinant |
| Source | Wheat germ |
| Tag/Conjugation | proprietary tag N-Terminus |
| SwissProt/Accession | P09488 |
| Gene | GSTM1 |
| Residue | 1 to 100 |
| Sequence | MPMILGYWDIRGLAHAIRLLLEYTDSSYEEKKYTMGDAPDYDRSQWLNEK FKLGLDFPNLPYLIDGAHKITQSNAILCYIARKHNLCGETEEEKIRVDIL |
| Supplier Page | Shop |
Product images
ab158600 on a 12.5% SDS-PAGE stained with Coomassie Blue.