Human Glutathione S Transferase theta 2 protein fragment
| Name | Human Glutathione S Transferase theta 2 protein fragment |
|---|---|
| Supplier | Abcam |
| Catalog | ab116911 |
| Category | Protein |
| Applications | ELISA SDS-PAGE WB |
| Species Reactivities | Human |
| Nature | Recombinant |
| Source | Wheat germ |
| SwissProt/Accession | P0CG30 |
| Gene | GSTT2B |
| Residue | 145 to 244 |
| Sequence | WLEDKFLGDRPFLAGQQVTLADLMALEELMQPVALGYELFEGRPRLAAWR GRVEAFLGAELCQEAHSIILSILEQAAKKTLPTPSPEAYQAMLLRIARIP |
| Supplier Page | Shop |
Product images
12.5% SDS-PAGE stained with Coomassie Blue showing ab116911 at approximately 36.63 kDa.