| Name | Human TFF2 protein |
|---|---|
| Supplier | Biorbyt |
| Catalog | orb169417 |
| Category | Protein |
| Prices | $187.00, $323.00, $3,128.00 |
| Sizes | 5 μg, 20 μg, 1 mg |
| Applications | SDS-PAGE |
| Species Reactivities | Human |
| Purity | >98% |
| Bioactivity | Assay #1: Determined by its ability to chemoattract human monocytes using a concentration range of 1.0-10.0 µg/ml. Assay #2: Determined by its ability to chemoattract human MCF-7 cells using a concentration range of 1.0-10.0 ng/ml. |
| Gene | TFF2 |
| Sequence | AEKPSPCQCSRLSPHNRTNCGFPGITSDQCFDNGCCFDSSVTGVPWCFHPLPKQESDQCVMEVSDRRNCGYPGISPEECASRKCCFSNFIFEVPWCFFPKSVEDCHY |
| Description | Recombinant Human TFF2 protein |
| Supplier Page | Shop |