Human GNLY full length protein
| Name | Human GNLY full length protein |
|---|---|
| Supplier | Abcam |
| Catalog | ab175462 |
| Category | Protein |
| Applications | WB MS ELISA SDS-PAGE |
| Species Reactivities | Human |
| Nature | Recombinant |
| Source | E. coli |
| Tag/Conjugation | His tag N-Terminus |
| Purity | > 95 % Densitometry. ab175462 is purified using Ni-NTA chromatography. |
| Endotoxin | < 1.000 Eu/µg |
| SwissProt/Accession | P22749 |
| Gene | GNLY |
| Residue | 23 to 145 |
| Sequence | RLSPEYYDLARAHLRDEEKSCPCLAQEGPQGDLLTKTQELGRDYRTCLTI VQKLKKMVDKPTQRSVSNAATRVCRTGRSRWRDVCRNFMRRYQSRVTQGL VAGETAQQICEDLRLCIPSTGPL |
| Supplier Page | Shop |
Product images
14% SDS-PAGE analysis of ab175462 Lane 1: reduced and heated sample (2.5 μg) Lane 2: non-reduced and non-heated sample (2.5 μg)