| Name | Active human IL6 full length protein |
|---|---|
| Supplier | Abcam |
| Catalog | ab151943 |
| Category | Protein |
| Prices | $192.00 |
| Sizes | 10 µg |
| Applications | HPLC SDS-PAGE FA |
| Species Reactivities | Human |
| Nature | Recombinant |
| Source | E. coli |
| Tag/Conjugation | His tag C-Terminus |
| Purity | >95% by SDS-PAGE . ab151943 has purity greater than 98% as determined by RP-HPLC and reducing SDS-PAGE. 0.2 µM filtered. |
| Bioactivity | ab151943 is fully biologically active when compared to standards. ED 50 is less than 0.1 ng/ml as determined by the dose-dependent stimulation of Human TF1 cells. Specific Activity of 5.0 x 10 7 IU/mg. |
| Endotoxin | < 1.000 Eu/µg |
| SwissProt/Accession | P05231 |
| Gene | IL6 |
| Residue | 30 to 212 |
| Sequence | VPPGEDSKDVAAPHRQPLTSSERIDKQIRYILDGISALRKETCNKSNMCE SSKEALAENNLNLPKMAEKDGCFQSGFNEETCLVKIITGLLEFEVYLEYL QNRFESSEEQARAVQMSTKVLIQFLQKKAKNLDAITTPDPTTNASLLTKL QAQNQWLQDMTTHLILRSFKEFLQSSLRALRQM |
| Supplier Page | Shop |