Active human IL6 full length protein

Name Active human IL6 full length protein
Supplier Abcam
Catalog ab9627
Category Protein
Prices $257.00
Sizes 20 µg
Applications SDS-PAGE FA B/N
Species Reactivities Human
Nature Recombinant
Source E. coli
Purity > 98 % by SDS-PAGE. Sterile filtered. Greater than 98% pure by SDS-PAGE and HPLC analyses.
Bioactivity Determined by its ability to stimulate the proliferation of the IL-6 dependent mouse 7TD1 cells.The expected ED 50 is ≤0.1 ng/mL, corresponding to a specific activity of ≥ 1 x 10 7 units/mg.
Endotoxin < 0.100 Eu/µg
SwissProt/Accession P05231
Gene IL6
Residue 1 to 184
Sequence PVPPGEDSKDVAAPHRQPLTSSERIDKQIRYILDGISALRKETCNKSNMC ESSKEALAENNLNLPKMAEKDGCFQSGFNEETCLVKIITGLLEFEVYLEY LQNRFESSEEQARAVQMSTKVLIQFLQKKAKNLDAITTPDPTTNASLLTK LQAQNQWLQDMTTHLILRSFKEFLQSSLRALRQM
Supplier Page Shop