Active human IL7 full length protein
| Name | Active human IL7 full length protein |
|---|---|
| Supplier | Abcam |
| Catalog | ab155728 |
| Category | Protein |
| Prices | $239.00 |
| Sizes | 10 µg |
| Applications | FA SDS-PAGE |
| Species Reactivities | Human |
| Nature | Recombinant |
| Source | HEK 293 cells |
| Purity | >95% by SDS-PAGE . ab155728 was lyophilized from 0.22 µm filtered solution. |
| Bioactivity | The bio-activity was determined by dose-dependent stimulation of the proliferation of mouse 2E8 cells. The ED 50 <0.2ng/ml, corresponding to a specific activity of >5X10 6 Unit/mg |
| Endotoxin | < 1.000 Eu/µg |
| SwissProt/Accession | P13232 |
| Gene | IL7 |
| Residue | 26 to 177 |
| Sequence | DCDIEGKDGKQYESVLMVSIDQLLDSMKEIGSNCLNNEFNFFKRHICDAN KEGMFLFRAARKLRQFLKMNSTGDFDLHLLKVSEGTTILLNCTGQVKGRK PAALGEAQPTKSLEENKSLKEQKKLNDLCFLKRLLQEIKTCWNKILMGTK EH |
| Supplier Page | Shop |
Product images
SDS-PAGE analysis of reduced ab155728 staining overnight with Coomassie Blue.