Human Graves disease carrier protein / GDC protein fragment
| Name | Human Graves disease carrier protein / GDC protein fragment |
|---|---|
| Supplier | Abcam |
| Catalog | ab159936 |
| Category | Protein |
| Applications | WB ELISA |
| Species Reactivities | Human |
| Nature | Recombinant |
| Source | Wheat germ |
| Tag/Conjugation | proprietary tag N-Terminus |
| SwissProt/Accession | P16260 |
| Gene | SLC25A16 |
| Residue | 59 to 133 |
| Sequence | RVKVLLQAHNHHYKHLGVFSALRAVPQKEGFLGLYKGNGAMMIRIFPYGA IQFMAFEHYKTLITTKLGISGHVHR |
| Supplier Page | Shop |
Product images
ab159936 on a 12.5% SDS-PAGE stained with Coomassie Blue.