Human HCF-1 / Host Cell Factor C1 protein fragment
| Name | Human HCF-1 / Host Cell Factor C1 protein fragment |
|---|---|
| Supplier | Abcam |
| Catalog | ab117018 |
| Category | Protein |
| Applications | WB SDS-PAGE ELISA |
| Species Reactivities | Human |
| Nature | Recombinant |
| Source | Wheat germ |
| SwissProt/Accession | P51610 |
| Gene | HCFC1 |
| Residue | 665 to 751 |
| Sequence | KSPISVPGGSALISNLGKVMSVVQTKPVQTSAVTGQASTGPVTQIIQTKG PLPAGTILKLVTSADGKPTTIITTTQASGAGTKPTIL |
| Supplier Page | Shop |
Product images
12.5% SDS-PAGE showing ab117018 at approximately 35.20 kDa. Stained with Coomassie Blue.