Human hCG alpha full length protein
| Name | Human hCG alpha full length protein |
|---|---|
| Supplier | Abcam |
| Catalog | ab194141 |
| Category | Protein |
| Applications | SDS-PAGE |
| Species Reactivities | Human |
| Nature | Recombinant |
| Source | Mammalian |
| Tag/Conjugation | StrepII tag N-Terminus |
| Purity | >95% by SDS-PAGE . |
| Endotoxin | < 0.100 Eu/µg |
| SwissProt/Accession | P01215 |
| Gene | CGA |
| Residue | 25 to 116 |
| Sequence | APDVQDCPECTLQENPFFSQPGAPILQCMGCCFSRAYPTPLRSKKTMLVQ KNVTSESTCCVAKSYNRVTVMGGFKVENHTACHCSTCYYHKS |
| Supplier Page | Shop |
Product images
SDS-PAGE analysis of 2 μg ab194141.