| Name | Human HDGF protein fragment |
|---|---|
| Supplier | Abcam |
| Catalog | ab173057 |
| Category | Protein |
| Applications | HPLC SDS-PAGE |
| Species Reactivities | Human |
| Nature | Recombinant |
| Source | E. coli |
| Tag/Conjugation | His tag C-Terminus |
| Purity | >95% by SDS-PAGE . The purity of ab173057 is greater than 95% ,as determined by SEC-HPLC and reducing SDS-PAGE. It is supplied as an 0.2 µM filtered solution. |
| Endotoxin | < 1.000 Eu/µg |
| SwissProt/Accession | P51858 |
| Gene | HDGF |
| Residue | 1 to 100 |
| Sequence | MSRSNRQKEYKCGDLVFAKMKGYPHWPARIDEMPEAAVKSTANKYQVFFF GTHETAFLGPKDLFPYEESKEKFGKPNKRKGFSEGLWEIENNPTVKASGY |
| Supplier Page | Shop |