Active human Interferon gamma full length protein
| Name | Active human Interferon gamma full length protein |
|---|---|
| Supplier | Abcam |
| Catalog | ab194162 |
| Category | Protein |
| Prices | $155.00 |
| Sizes | 10 µg |
| Applications | SDS-PAGE FA |
| Species Reactivities | Human |
| Nature | Recombinant |
| Source | Mammalian |
| Tag/Conjugation | StrepII tag C-Terminus |
| Purity | > 80 % by SDS-PAGE. Chemically-defined, serum- and animal-product-free culture medium. |
| Bioactivity | Biologial Activity: ED 50 is 0.001-0.01 ng/ml as determined by rescuing TNF-a cytotoxicity assay. |
| Endotoxin | < 0.100 Eu/µg |
| SwissProt/Accession | P01579 |
| Gene | IFNG |
| Residue | 24 to 166 |
| Sequence | QDPYVKEAENLKKYFNAGHSDVADNGTLFLGILKNWKEESDRKIMQSQIV SFYFKLFKNFKDDQSIQKSVETIKEDMNVKFFNSNKKKRDDFEKLTNYSV TDLNVQRKAIHELIQVMAELSPAAKTGKRKRSQMLFRGRRASQ |
| Supplier Page | Shop |
Product images
The bioactivity of ab194162 was determined by rescuing TNF-a cytotoxicity assay.