Active human intestinal FABP full length protein
| Name | Active human intestinal FABP full length protein |
|---|---|
| Supplier | Abcam |
| Catalog | ab179974 |
| Category | Protein |
| Prices | $385.00 |
| Sizes | 200 µg |
| Applications | SDS-PAGE FA |
| Species Reactivities | Human |
| Nature | Recombinant |
| Source | E. coli |
| Tag/Conjugation | His tag N-Terminus |
| Purity | > 98 % by SDS-PAGE. |
| Bioactivity | The binding affinity of ab179974 for the synthetic ligand cis-parinaric acid has been measured by fluorescence titration. Half-maximal fluorescence of 3 µM ab179974 is achieved with approximately 3 µM cis-paranaric acid. |
| Endotoxin | < 1.000 Eu/µg |
| SwissProt/Accession | P12104 |
| Gene | FABP2 |
| Residue | 2 to 132 |
| Sequence | AFDSTWKVDRSENYDKFMEKMGVNIVKRKLAAHDNLKLTITQEGNKFTVK ESSTFRNIEVVFELGVTFNYNLADGTELRGTWSLEGNKLIGKFKRTDNGN ELNTVREIIGDELVQTYVYEGVEAKRIFKKD |
| Supplier Page | Shop |
Product images
DTT-reduced SDS-PAGE analysis of ab179974 stained overnight with Coomassie Blue.