| Name | Active human IP10 full length protein |
|---|---|
| Supplier | Abcam |
| Catalog | ab138797 |
| Category | Protein |
| Prices | $192.00 |
| Sizes | 10 µg |
| Applications | SDS-PAGE HPLC FA |
| Species Reactivities | Human |
| Nature | Recombinant |
| Source | E. coli |
| Tag/Conjugation | His tag C-Terminus |
| Purity | >95% by SDS-PAGE . Purity > 95% as determined by SEC-HPLC and reducing SDS-PAGE. |
| Bioactivity | The ED 50 of ab138797 as determined by its ability to chemoattract Human CXCR3 transfected BaF3 mouse proB cells was 0.02-0.06 µg/ml. |
| Endotoxin | < 1.000 Eu/µg |
| SwissProt/Accession | P02778 |
| Gene | CXCL10 |
| Residue | 22 to 98 |
| Sequence | VPLSRTVRCTCISISNQPVNPRSLEKLEIIPASQFCPRVEIIATMKKKGE KRCLNPESKAIKNLLKAVSKERSKRSP |
| Supplier Page | Shop |