Active human IP10 full length protein

Name Active human IP10 full length protein
Supplier Abcam
Catalog ab191783
Category Protein
Prices $192.00
Sizes 25 µg
Applications SDS-PAGE FA
Species Reactivities Human
Nature Recombinant
Source E. coli
Purity >95% by SDS-PAGE .
Bioactivity Determined by its ability to chemoattract Human T-Lymphocytes using a concentration of 10-50 ng/ml.
Endotoxin < 1.000 Eu/µg
SwissProt/Accession P02778
Gene CXCL10
Residue 22 to 98
Sequence VPLSRTVRCTCISISNQPVNPRSLEKLEIIPASQFCPRVEIIATMKKKGE KRCLNPESKAIKNLLKAVSKERSKRSP
Supplier Page Shop