Active dog GM-CSF full length protein

Name Active dog GM-CSF full length protein
Supplier Abcam
Catalog ab200292
Category Protein
Prices $101.00
Sizes 5 µg
Applications FA HPLC SDS-PAGE
Species Reactivities Dog
Nature Recombinant
Source E. coli
Purity >95% by SDS-PAGE .
Bioactivity The ED 50 determined by a cell proliferation assay using Human TF-1 cells is less than 4 ng/mL, corresponding to a specific activity of >2.5 x 10 5 IU/mg.
Endotoxin < 1.000 Eu/µg
SwissProt/Accession P04141
Gene CSF2
Residue 18 to 144
Sequence APTRSPTLVTRPSQHVDAIQEALSLLNNSNDVTAVMNKAVKVVSEVFDPE GPTCLETRLQLYKEGLQGSLTSLKNPLTMMANHYKQHCPPTPESPCATQN NFKSFKENLKDFLFNIPFDCWKPVKK
Supplier Page Shop