ATAT1 Recombinant Protein Antigen

Name ATAT1 Recombinant Protein Antigen
Supplier Novus Biologicals
Catalog NBP2-48990PEP
Category Protein
Prices $209.00
Sizes 100 µl
Applications B/N
For Antibody ATAT1 Antibody
Species Reactivities Human
Nature Recombinant
Source E. coli
Purity >80% by SDS-PAGE and Coomassie blue staining
Gene ATAT1
Sequence QQIMTIIDELGKASAKAQNLSAPITSASRMQSNRHVVYILKDSSARPAGKGAIIGFIKVGYKKLFVLDDR
Description A recombinant protein to ATAT1
Supplier Page Shop