HSD17B2 Recombinant Protein Antigen

Name HSD17B2 Recombinant Protein Antigen
Supplier Novus Biologicals
Catalog NBP2-48956PEP
Category Protein
Prices $209.00
Sizes 100 µl
Applications B/N
For Antibody HSD17B2 Antibody
Species Reactivities Human
Nature Recombinant
Source E. coli
Purity >80% by SDS-PAGE and Coomassie blue staining
Gene HSD17B2
Sequence LVTGGDCGLGHALCKYLDELGFTVFAGVLNENGPGAEELRRTCSPRLSVLQMDITKPVQIKDAYSKVAAMLQDRGLWAVINNAGVLGFPTDGELLLMTDYKQCMAVNFFGTV
Description A recombinant protein to HSD17B2
Supplier Page Shop