C16orf71 Recombinant Protein Antigen

Name C16orf71 Recombinant Protein Antigen
Supplier Novus Biologicals
Catalog NBP2-48935PEP
Category Protein
Prices $199.00
Sizes 100 µl
For Antibody C16orf71 Antibody
Species Reactivities Human
Nature Recombinant
Source E. coli
Purity >80% by SDS-PAGE and Coomassie blue staining
Gene C16orf71
Sequence MASNDKGMAPSLGSPWASQMGPWDAILKAVKDQLPSLDSDSPLSDYGEEELFIFQRNQTSLIPDLSEELAEDPADG
Description A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human C16orf71
Supplier Page Shop