WDR87 Recombinant Protein Antigen

Name WDR87 Recombinant Protein Antigen
Supplier Novus Biologicals
Catalog NBP2-48934PEP
Category Protein
Prices $209.00
Sizes 100 µl
Applications B/N
For Antibody WDR87 Antibody
Species Reactivities Human
Nature Recombinant
Source E. coli
Purity >80% by SDS-PAGE and Coomassie blue staining
Gene WDR87
Sequence RSSMHYSLQDMEDWMQVSKRYQCHYVLPPQLQLTSWDGLNPYQILRYYFGHGREWLFAPDCYIPNSVIRARLWPEGTPIYLQCN
Description A recombinant protein to WDR87
Supplier Page Shop