TMEM247 Recombinant Protein Antigen

Name TMEM247 Recombinant Protein Antigen
Supplier Novus Biologicals
Catalog NBP2-48928PEP
Category Protein
Prices $209.00
Sizes 100 µl
Applications B/N
For Antibody TMEM247 Antibody
Species Reactivities Human
Nature Recombinant
Source E. coli
Purity >80% by SDS-PAGE and Coomassie blue staining
Gene TMEM247
Sequence SVLVFWMAAEDREMMEARGAGESCPTFPKMVPGDSKSEGKPRAYLEAESQKPDSSYDYLEEMEACEDGGCQGPLKSLSPKSCRAT
Description A recombinant protein to TMEM247
Supplier Page Shop