TRIM3/BERP Recombinant Protein Antigen

Name TRIM3/BERP Recombinant Protein Antigen
Supplier Novus Biologicals
Catalog NBP2-48897PEP
Category Protein
Prices $199.00
Sizes 100 µl
For Antibody TRIM3/BERP Antibody
Species Reactivities Human
Nature Recombinant
Source E. coli
Purity >80% by SDS-PAGE and Coomassie blue staining
Gene TRIM3
Sequence QHKAALQRQLEAVRGRLPQLSAAIALVGGISQQLQERKAEALAQISAAFEDLEQALQQRKQALVSDLETICGAKQKVLQ
Description A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human TRIM3/BERP. Source: E. coli Amino Acid Sequence: QHKAALQRQLEAVRGRLPQLSAAIALVGGISQQLQERKAEALAQISAAFEDLEQALQQRKQALVSDLETICGAKQKVLQ
Supplier Page Shop