C11orf46 Recombinant Protein Antigen

Name C11orf46 Recombinant Protein Antigen
Supplier Novus Biologicals
Catalog NBP2-48890PEP
Category Protein
Prices $199.00
Sizes 100 µl
For Antibody C11orf46 Antibody
Species Reactivities Human
Nature Recombinant
Source E. coli
Purity >80% by SDS-PAGE and Coomassie blue staining
Gene ARL14EP
Sequence FSGMDLCDCLDEDCLGCFYACPACGSTKCGAECRCDRKWLYEQIEIEGGEIIHNKHA
Description A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human C11orf46
Supplier Page Shop