Ribosomal Protein L17 Recombinant Protein Antigen

Name Ribosomal Protein L17 Recombinant Protein Antigen
Supplier Novus Biologicals
Catalog NBP2-48845PEP
Category Protein
Prices $199.00
Sizes 100 µl
For Antibody Ribosomal Protein L17 Antibody
Species Reactivities Human
Nature Recombinant
Source E. coli
Purity >80% by SDS-PAGE and Coomassie blue staining
Gene RPL17
Sequence RAHGRINPYMSSPCHIEMILTEKEQIVPKPEEEVAQKKKISQKKLK
Description A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human Ribosomal Protein L17
Supplier Page Shop