NK3R/TACR3/Neurokinin B Receptor Recombinant Protein Antigen

Name NK3R/TACR3/Neurokinin B Receptor Recombinant Protein Antigen
Supplier Novus Biologicals
Catalog NBP1-82561PEP
Category Protein
Prices $199.00
Sizes 100 µl
For Antibody NK3R/TACR3/Neurokinin B Receptor Antibody
Species Reactivities Human
Nature Recombinant
Source E.coli
Purity >80% by SDS-PAGE and Coomassie blue staining
Gene TACR3
Sequence MATLPAAETWIDGGGGVGADAVNLTASLAAGAATGAVETGWLQLLDQAGNLSSSPSALGLPVASPAPSQPWANLTNQFVQPSWRIALWS
Description A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human TACR3
Supplier Page Shop