NKIAMRE Recombinant Protein Antigen

Name NKIAMRE Recombinant Protein Antigen
Supplier Novus Biologicals
Catalog NBP1-82557PEP
Category Protein
Prices $209.00
Sizes 100 µl
Applications B/N
For Antibody NKIAMRE Antibody
Species Reactivities Human
Nature Recombinant
Source E.coli
Purity >80% by SDS-PAGE and Coomassie blue staining
Gene CDKL3
Sequence AKVNSLIKPKESSKENELRKDERKTVYTNTLLSSSVLGKEIEKEKKPKEIKVRVIKVKGGRGDISEPKKKEYEGGLGQQDANENVHPMSPDTKLVTIEPPNPINPSTNCN
Description A recombinant protein antigen corresponding to CDKL3
Supplier Page Shop