| Name | Liprin alpha 2 Recombinant Protein Antigen |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-90977PEP |
| Category | Protein |
| Prices | $209.00 |
| Sizes | 100 µl |
| Applications | B/N |
| For Antibody | Liprin alpha 2 Antibody |
| Species Reactivities | Human |
| Nature | Recombinant |
| Source | E. coli |
| Purity | >80% by SDS-PAGE and Coomassie blue staining |
| Gene | PPFIA2 |
| Sequence | EPTIPRTHLDTSAELRYSVGSLVDSQSDYRTTKVIRRPRRGRMGVRRDEPKVKSLGDHEWNRTQQIGVLSSHPFESDTEMSDIDDDD |
| Description | A recombinant protein to Liprin alpha 2 |
| Supplier Page | Shop |