KIAA0355 Recombinant Protein Antigen

Name KIAA0355 Recombinant Protein Antigen
Supplier Novus Biologicals
Catalog NBP1-90943PEP
Category Protein
Prices $199.00
Sizes 100 µl
For Antibody KIAA0355 Antibody
Species Reactivities Human
Nature Recombinant
Source E. coli
Purity >80% by SDS-PAGE and Coomassie blue staining
Gene KIAA0355
Sequence GCYNGITSRDDFPVTEVLNQVCPSTWRGACKTAVQLLFGQAGLVVVDTAQIENKEAYAPQISLEGSRIVVQVPSTWCLKEDPATMSLLQRSLDPEKTLGLVDVL
Description A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human KIAA0355
Supplier Page Shop