CDCP2 Recombinant Protein Antigen

Name CDCP2 Recombinant Protein Antigen
Supplier Novus Biologicals
Catalog NBP1-87438PEP
Category Protein
Prices $199.00
Sizes 100 µl
For Antibody CDCP2 Antibody
Species Reactivities Human
Nature Recombinant
Source E. coli
Purity >80% by SDS-PAGE and Coomassie blue staining
Gene CDCP2
Sequence RGNFSSPQYPSSYPNNIRCHWTIRLPPGYQVKVFFLDLDLEEPNSLTKTCDFDHLAAFDGASEEAPLLGNWCGHHLPPPVTSSHNQ
Description A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human CDCP2
Supplier Page Shop