LENG9 Recombinant Protein Antigen

Name LENG9 Recombinant Protein Antigen
Supplier Novus Biologicals
Catalog NBP2-30893PEP
Category Protein
Prices $209.00
Sizes 100 µl
Applications B/N
For Antibody LENG9 Antibody
Species Reactivities Human
Nature Recombinant
Source E.coli
Purity >80% by SDS-PAGE and Coomassie blue staining
Gene LENG9
Sequence NFLVPSQNLHLTLALLRLAGAGEEAAAIGALRRALLAPGLNAPPRLSFRKLVLLGPHVLCAPPSPTLESMAQVLSQRLEAEGLSTLQSPGQLHPHLTVAKVPHGSQV
Description A recombinant protein antigen corresponding to LENG9
Supplier Page Shop