CYP2U1 Recombinant Protein Antigen

Name CYP2U1 Recombinant Protein Antigen
Supplier Novus Biologicals
Catalog NBP2-30991PEP
Category Protein
Prices $199.00
Sizes 100 µl
For Antibody CYP2U1 Antibody
Species Reactivities Human
Nature Recombinant
Source E.coli
Purity >80% by SDS-PAGE and Coomassie blue staining
Gene CYP2U1
Sequence LPFGPFKELRQIEKDITSFLKKIIKDHQESLDRENPQDFIDMYLLHMEEERK
Description A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human CYP2U1
Supplier Page Shop